PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC12142_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family SBP
Protein Properties Length: 144aa    MW: 16871.6 Da    PI: 10.577
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC12142_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP59.58.6e-19246953
                 ---TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETT CS
          SBP  9 adlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhels 53
                 +dls ak+yhrrhkvCevhska ++lv +++qrfCqqCsr  +ls
  RrC12142_p1  2 EDLSVAKDYHRRHKVCEVHSKAIKALVGNQMQRFCQQCSRCKSLS 46
                 69**************************************98886 PP

2SBP51.92e-1661914878
                 SEEETTT--SS--S-STTTT-------S--- CS
          SBP 48 rfhelsefDeekrsCrrrLakhnerrrkkqa 78
                 rfh lsefDe+krsCrrrLa+hn+rrrk+q+
  RrC12142_p1 61 RFHLLSEFDEGKRSCRRRLAGHNKRRRKTQP 91
                 9***************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114123.23189IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.7E-22276IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.79E-17246IPR004333Transcription factor, SBP-box
PfamPF031104.3E-13346IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.26E-136194IPR004333Transcription factor, SBP-box
PfamPF031101.3E-86188IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MEDLSVAKDY HRRHKVCEVH SKAIKALVGN QMQRFCQQCS RCKSLSYRVT AVSSLELLAV  60
RFHLLSEFDE GKRSCRRRLA GHNKRRRKTQ PEEIVAPHNN TSNMDVGTMV VDLMGLRQCH  120
KGSNYFRYLT KLKRYRCLWI LSQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-223881984squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013620809.16e-44PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_013693690.16e-44PREDICTED: squamosa promoter-binding-like protein 16
RefseqXP_013693697.16e-44PREDICTED: squamosa promoter-binding-like protein 16
SwissprotQ700C26e-40SPL16_ARATH; Squamosa promoter-binding-like protein 16
TrEMBLA0A078G1G75e-44A0A078G1G7_BRANA; BnaC02g24160D protein
TrEMBLA0A0D3AR236e-44A0A0D3AR23_BRAOL; Uncharacterized protein
STRINGBra015732.1-P1e-40(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76580.14e-41SBP family protein